KIF3A Antikörper (C-Term)

Produktnummer ABIN634174

Produktdetails anti-KIF3A Antikörper

Target: KIF3A (Kinesin Family Member 3A (KIF3A))

Bindungsspezifität: C-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIF3A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KIF3 A antibody was raised against the C terminal of KIF3

Aufreinigung: Affinity purified

Immunogen: KIF3 A antibody was raised using the C terminal of KIF3 corresponding to a region with amino acids PVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIF3A Blocking Peptide, catalog no. 33R-7417, is also available for use as a blocking control in assays to test for specificity of this KIF3A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIF3A

Target: KIF3A (Kinesin Family Member 3A (KIF3A))

Andere Bezeichnung: KIF3A (KIF3A Produkte)

Synonyme: FLA10 antikoerper, KLP-20 antikoerper, 111-11-71 antikoerper, 111-11-86 antikoerper, AW124694 antikoerper, Kif3 antikoerper, Kifl antikoerper, Kns3 antikoerper, kinesin family member 3A antikoerper, kinesin family member 3a antikoerper, KIF3A antikoerper, Kif3a antikoerper

Hintergrund: KIF3A/B is a kinesin involved in intraflagellar transport and Golgi trafficking.

Molekulargewicht: 80 kDa (MW of target protein)

Pathways: Hedgehog Signalweg