UBE2C Antikörper (N-Term)
-
- Target Alle UBE2C Antikörper anzeigen
- UBE2C (Ubiquitin-Conjugating Enzyme E2C (UBE2C))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UBE2C Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- UBE2 C antibody was raised against the N terminal of UBE2
- Aufreinigung
- Affinity purified
- Immunogen
- UBE2 C antibody was raised using the N terminal of UBE2 corresponding to a region with amino acids ELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPS
- Top Product
- Discover our top product UBE2C Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UBE2C Blocking Peptide, catalog no. 33R-2562, is also available for use as a blocking control in assays to test for specificity of this UBE2C antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBE0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UBE2C (Ubiquitin-Conjugating Enzyme E2C (UBE2C))
- Andere Bezeichnung
- UBE2C (UBE2C Produkte)
- Hintergrund
- The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2C is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell cycle progression.
- Molekulargewicht
- 20 kDa (MW of target protein)
- Pathways
- Ubiquitin Proteasome Pathway
-