MSH5 Antikörper

Produktnummer ABIN634152

Dieser Anti-MSH5 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von MSH5 in WB. Geeignet für Human und Ratte.

Kurzübersicht für MSH5 Antikörper (ABIN634152)

Target: MSH5 (MutS Homolog 5 (MSH5))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MSH5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MSH5 Antikörper

Aufreinigung: Affinity purified

Immunogen: MSH5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DENMTRFLGKLASQEHREPKRPEIIFLPSVDFGLEISKQRLLSGNYSFIP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MSH5 Blocking Peptide, (ABIN937301), is also available for use as a blocking control in assays to test for specificity of this MSH5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSH5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MSH5

Target: MSH5 (MutS Homolog 5 (MSH5))

Andere Bezeichnung: MSH5

Hintergrund: MSH5 is a member of the mutS family of proteins that are involved in DNA mismatch repair or meiotic recombination processes. This protein is similar to a Saccharomyces cerevisiae protein that participates in meiotic segregation fidelity and crossing-over. This protein forms heterooligomers with another member of this family, mutS homolog 4.

Molekulargewicht: 93 kDa (MW of target protein)

Pathways: M Phase