RPA1 Antikörper (Middle Region)

Produktnummer ABIN634118

Der Kaninchen Polyklonal anti-RPA1 Antikörper wird verwendet zum Nachweis von RPA1 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für RPA1 Antikörper (Middle Region) (ABIN634118)

Target: RPA1 (Replication Protein A1, 70kDa (RPA1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPA1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RPA1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: RPA1 antibody was raised against the middle region of RPA1

Aufreinigung: Affinity purified

Immunogen: RPA1 antibody was raised using the middle region of RPA1 corresponding to a region with amino acids SRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPA1 Blocking Peptide, (ABIN5615927), is also available for use as a blocking control in assays to test for specificity of this RPA1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPA1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPA1

Target: RPA1 (Replication Protein A1, 70kDa (RPA1))

Andere Bezeichnung: RPA1

Hintergrund: RPA1 plays an essential role in several cellular processes in DNA metabolism including replication, recombination and DNA repair.

Molekulargewicht: 68 kDa (MW of target protein)

Pathways: Telomere Maintenance, DNA Reparatur, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA