KIF2A Antikörper (C-Term)

Produktnummer ABIN634105

Produktdetails anti-KIF2A Antikörper

Target: KIF2A (Kinesin Heavy Chain Member 2A (KIF2A))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KIF2A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KIF2 A antibody was raised against the C terminal of KIF2

Aufreinigung: Affinity purified

Immunogen: KIF2 A antibody was raised using the C terminal of KIF2 corresponding to a region with amino acids ETQWGVGSSPQRDDLKLLCEQNEEEVSPQLFTFHEAVSQMVEMEEQVVED

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KIF2A Blocking Peptide, catalog no. 33R-2768, is also available for use as a blocking control in assays to test for specificity of this KIF2A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KIF2A

Target: KIF2A (Kinesin Heavy Chain Member 2A (KIF2A))

Andere Bezeichnung: KIF2A (KIF2A Produkte)

Synonyme: HK2 antikoerper, KIF2 antikoerper, C530030B14Rik antikoerper, Kif2 antikoerper, Kns2 antikoerper, M-kinesin antikoerper, kif2-a antikoerper, fj55b02 antikoerper, wu:fj55b02 antikoerper, kinesin family member 2A antikoerper, kinesin heavy chain member 2A L homeolog antikoerper, kinesin heavy chain member 2A antikoerper, zgc:103670 antikoerper, Kinesin-2 antikoerper, KIF2A antikoerper, Kif2a antikoerper, kif2a.L antikoerper, zgc:103670 antikoerper, GL50803_17333 antikoerper, GL50803_16456 antikoerper

Hintergrund: KIF2A belongs to the kinesin-like protein family, MCAK/KIF2 subfamily. It contains 1 kinesin-motor domain. KIF2A plus end-directed microtubule-dependent motor required for normal brain development. It may regulate microtubule dynamics during axonal growth. KIF2A is implicated in formation of bipolar mitotic spindles. It has microtubule depolymerization activity. Hela cells lacking KIF2A show asymmetric or monopolar mitotic spindles. Osteosarcoma cells (U2OS) lacking KIF2A or KIF2B show disorganised or monopolar mitotic spindles.

Molekulargewicht: 80 kDa (MW of target protein)

Pathways: Microtubule Dynamics, Ribonucleoprotein Complex Subunit Organization