POLK Antikörper

Produktnummer ABIN634095

Produktdetails anti-POLK Antikörper

Target: POLK (Polymerase (DNA Directed) kappa (POLK))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POLK Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: POLK antibody was raised using a synthetic peptide corresponding to a region with amino acids KINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

POLK Blocking Peptide, catalog no. 33R-4442, is also available for use as a blocking control in assays to test for specificity of this POLK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu POLK

Target: POLK (Polymerase (DNA Directed) kappa (POLK))

Andere Bezeichnung: POLK (POLK Produkte)

Synonyme: DINB1 antikoerper, DINP antikoerper, POLQ antikoerper, Dinb1 antikoerper, POLK antikoerper, si:ch211-254o18.3 antikoerper, DNA polymerase kappa antikoerper, polymerase (DNA directed) kappa antikoerper, polymerase (DNA directed), kappa antikoerper, polymerase (DNA directed) kappa L homeolog antikoerper, POLK antikoerper, Polk antikoerper, polk antikoerper, Tb11.01.0080 antikoerper, Tb11.01.0010 antikoerper, Tb11.01.0020 antikoerper, Tb11.01.0030 antikoerper, Tb11.01.0040 antikoerper, Tb11.01.0050 antikoerper, Tb11.12.0001 antikoerper, Tb11.12.0002 antikoerper, Tb11.12.0003 antikoerper, polk.L antikoerper, polk-1 antikoerper

Hintergrund: POLK belongs to the DNA polymerase type-Y family. It contains 2 Rad18-type zinc fingers and 1 umuC domain. POLK is a DNA polymerase specifically involved in DNA repair. It plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls.

Molekulargewicht: 99 kDa (MW of target protein)

Pathways: DNA Reparatur