MAPK4 Antikörper (Middle Region)

Produktnummer ABIN634082

Produktdetails anti-MAPK4 Antikörper

Target: MAPK4 (Mitogen-Activated Protein Kinase 4 (MAPK4))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MAPK4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MAPK4 antibody was raised against the middle region of MAPK4

Aufreinigung: Affinity purified

Immunogen: MAPK4 antibody was raised using the middle region of MAPK4 corresponding to a region with amino acids DFLEKILTFNPMDRLTAEMGLQHPYMSPYSCPEDEPTSQHPFRIEDEIDD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MAPK4 Blocking Peptide, catalog no. 33R-1930, is also available for use as a blocking control in assays to test for specificity of this MAPK4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPK4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MAPK4

Target: MAPK4 (Mitogen-Activated Protein Kinase 4 (MAPK4))

Andere Bezeichnung: MAPK4 (MAPK4 Produkte)

Synonyme: ERK-4 antikoerper, ERK3 antikoerper, Erk4 antikoerper, MAPK 4 antikoerper, PRKM4 antikoerper, p63MAPK antikoerper, A330097D03Rik antikoerper, Erk3 antikoerper, Prkm4 antikoerper, p63Mapk antikoerper, erk4 antikoerper, wu:fi27d11 antikoerper, zgc:55498 antikoerper, ATMPK4 antikoerper, F2N1.1 antikoerper, F2N1_1 antikoerper, MAP kinase 4 antikoerper, mitogen-activated protein kinase 4 antikoerper, MAP kinase 4 antikoerper, MAPK4 antikoerper, Mapk4 antikoerper, mapk4 antikoerper, MPK4 antikoerper

Hintergrund: Mitogen-activated protein kinase 4 is a member of the mitogen-activated protein kinase family. Tyrosine kinase growth factor receptors activate mitogen-activated protein kinases which then translocate into the nucleus where it phosphorylates nuclear targets.

Molekulargewicht: 66 kDa (MW of target protein)

Pathways: MAPK Signalweg