RFC3 Antikörper

Produktnummer ABIN634080

Dieser Anti-RFC3 Antikörper ist ein Kaninchen Polyklonal Antikörper zur Detektion von RFC3 in WB. Geeignet für Human und Hund.

Kurzübersicht für RFC3 Antikörper (ABIN634080)

Target: RFC3 (Replication Factor C (Activator 1) 3, 38kDa (RFC3))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RFC3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-RFC3 Antikörper

Aufreinigung: Affinity purified

Immunogen: RFC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids YHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RFC3 Blocking Peptide, (ABIN936090), is also available for use as a blocking control in assays to test for specificity of this RFC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RFC3

Target: RFC3 (Replication Factor C (Activator 1) 3, 38kDa (RFC3))

Andere Bezeichnung: RFC3

Hintergrund: The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. RFC3 is the 38 kDa subunit. This subunit is essential for the interaction between the 140 kDa subunit and the core complex that consists of the 36, 37, and 40 kDa subunits.

Molekulargewicht: 40 kDa (MW of target protein)

Pathways: Telomere Maintenance, DNA Reparatur, DNA Replication, Synthesis of DNA