CES5A Antikörper (Middle Region)
-
- Target Alle CES5A Antikörper anzeigen
- CES5A (Carboxylesterase 5A (CES5A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CES5A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Carboxylesterase 7 antibody was raised against the middle region of CES7
- Aufreinigung
- Affinity purified
- Immunogen
- Carboxylesterase 7 antibody was raised using the middle region of CES7 corresponding to a region with amino acids LTEIRDSLLDLLGDVFFVVPALITARYHREGATEEEKLLSRKMMKYWATF
- Top Product
- Discover our top product CES5A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Carboxylesterase 7 Blocking Peptide, catalog no. 33R-5471, is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CES7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CES5A (Carboxylesterase 5A (CES5A))
- Andere Bezeichnung
- Carboxylesterase 7 (CES5A Produkte)
- Synonyme
- CAUXIN antikoerper, CES4C1 antikoerper, CES5 antikoerper, CES7 antikoerper, 1700081L16Rik antikoerper, 1700122C07Rik antikoerper, BB081581 antikoerper, Ces7 antikoerper, Gm503 antikoerper, cauxin antikoerper, Ces5 antikoerper, LOC445455 antikoerper, carboxylesterase 5A antikoerper, CES5A antikoerper, Ces5a antikoerper
- Hintergrund
- CES7 belongs to the type-B carboxylesterase/lipase family. It is involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs.
- Molekulargewicht
- 58 kDa (MW of target protein)
-