CES5A Antikörper (N-Term)

Produktnummer ABIN634041

Produktdetails anti-CES5A Antikörper

Target: CES5A (Carboxylesterase 5A (CES5A))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CES5A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Carboxylesterase 7 antibody was raised against the N terminal of CES7

Aufreinigung: Affinity purified

Immunogen: Carboxylesterase 7 antibody was raised using the N terminal of CES7 corresponding to a region with amino acids SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carboxylesterase 7 Blocking Peptide, catalog no. 33R-8476, is also available for use as a blocking control in assays to test for specificity of this Carboxylesterase 7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CES7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CES5A

Target: CES5A (Carboxylesterase 5A (CES5A))

Andere Bezeichnung: Carboxylesterase 7 (CES5A Produkte)

Synonyme: CAUXIN antikoerper, CES4C1 antikoerper, CES5 antikoerper, CES7 antikoerper, 1700081L16Rik antikoerper, 1700122C07Rik antikoerper, BB081581 antikoerper, Ces7 antikoerper, Gm503 antikoerper, cauxin antikoerper, Ces5 antikoerper, LOC445455 antikoerper, carboxylesterase 5A antikoerper, CES5A antikoerper, Ces5a antikoerper

Hintergrund: CES7 belongs to the type-B carboxylesterase/lipase family. It is involved in the detoxification of xenobiotics and in the activation of ester and amide prodrugs.

Molekulargewicht: 58 kDa (MW of target protein)