RBP4 Antikörper (N-Term)

Produktnummer ABIN634030

Produktdetails anti-RBP4 Antikörper

Target: RBP4 (Retinol Binding Protein 4, Plasma (RBP4))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBP4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RBP4 antibody was raised against the N terminal of RBP4

Aufreinigung: Affinity purified

Immunogen: RBP4 antibody was raised using the N terminal of RBP4 corresponding to a region with amino acids MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBP4 Blocking Peptide, catalog no. 33R-6173, is also available for use as a blocking control in assays to test for specificity of this RBP4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBP4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBP4

Target: RBP4 (Retinol Binding Protein 4, Plasma (RBP4))

Andere Bezeichnung: RBP4 (RBP4 Produkte)

Synonyme: RDCCAS antikoerper, RBP antikoerper, RNBP antikoerper, rbp4 antikoerper, MGC54038 antikoerper, srbp antikoerper, PRBP antikoerper, RBPA antikoerper, Rbp-4 antikoerper, fb23c12 antikoerper, rbp antikoerper, wu:fb23c12 antikoerper, wu:fb58d04 antikoerper, wu:fb72b04 antikoerper, zgc:86911 antikoerper, retinol binding protein 4 antikoerper, renin binding protein antikoerper, retinol binding protein 4 S homeolog antikoerper, retinol binding protein 4 A, plasma antikoerper, retinol binding protein 4, plasma antikoerper, retinol binding protein 4 L homeolog antikoerper, RBP4 antikoerper, RENBP antikoerper, rbp4.S antikoerper, rbp4 antikoerper, Rbp4 antikoerper, RBP4A antikoerper, rbp4.L antikoerper

Hintergrund: This protein belongs to the lipocalin family and is the specific carrier for retinol (vitamin A alcohol) in the blood. It delivers retinol from the liver stores to the peripheral tissues.

Molekulargewicht: 21 kDa (MW of target protein)

Pathways: Regulatorische RNA Pathways, Positive Regulation of Peptide Hormone Secretion, Carbohydrate Homeostasis, Production of Molecular Mediator of Immune Response