GLA Antikörper (N-Term)

Produktnummer ABIN634024

Produktdetails anti-GLA Antikörper

Target: GLA (Galactosidase, alpha (GLA))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GLA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GLA antibody was raised against the N terminal of GLA

Aufreinigung: Affinity purified

Immunogen: GLA antibody was raised using the N terminal of GLA corresponding to a region with amino acids PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GLA Blocking Peptide, catalog no. 33R-7310, is also available for use as a blocking control in assays to test for specificity of this GLA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GLA

Target: GLA (Galactosidase, alpha (GLA))

Andere Bezeichnung: GLA (GLA Produkte)

Synonyme: GALA antikoerper, Ags antikoerper, zgc:101584 antikoerper, MGC130872 antikoerper, SMU.877 antikoerper, SCF11.21 antikoerper, AO090005000217 antikoerper, alpha-GAL antikoerper, galactosidase alpha antikoerper, galactosidase, alpha antikoerper, galactosidase alpha S homeolog antikoerper, alpha-galactosidase antikoerper, aga antikoerper, alpha-galactosidase A antikoerper, GLA antikoerper, Gla antikoerper, gla antikoerper, gla.S antikoerper, agaN antikoerper, aga antikoerper, agaL antikoerper, SCO0541 antikoerper, rafA antikoerper, melA antikoerper, galA antikoerper, ANI_1_2528074 antikoerper, ANI_1_1502124 antikoerper, AOR_1_390174 antikoerper, CpipJ_CPIJ002066 antikoerper, MCYG_00962 antikoerper, MCYG_00791 antikoerper, Tsp_02909 antikoerper, Tsp_02508 antikoerper

Hintergrund: GLA is a homodimeric glycoprotein that hydrolyses the terminal alpha-galactosyl moieties from glycolipids and glycoproteins. This enzyme predominantly hydrolyzes ceramide trihexoside, and it can catalyze the hydrolysis of melibiose into galactose and glucose. A variety of mutations in this gene affect the synthesis, processing, and stability of this enzyme, which causes Fabry disease, a rare lysosomal storage disorder that results from a failure to catabolize alpha-D-galactosyl glycolipid moieties.

Molekulargewicht: 45 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom