IFNA7 Antikörper (N-Term)

Produktnummer ABIN634003

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch IFNA7 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für IFNA7 Antikörper (N-Term) (ABIN634003)

Target: IFNA7 (IFNa7) (Interferon, alpha 7 (IFNa7))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IFNA7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IFNA7 Antikörper

Bindungsspezifität: N-Term

Spezifität: IFN Alpha 7 antibody was raised against the N terminal of IFNA7

Aufreinigung: Affinity purified

Immunogen: IFN Alpha 7 antibody was raised using the N terminal of IFNA7 corresponding to a region with amino acids RALILLAQMGRISPFSCLKDRHEFRFPEEEFDGHQFQKTQAISVLHEMIQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IFN Alpha 7 Blocking Peptide, (ABIN5614146), is also available for use as a blocking control in assays to test for specificity of this IFN Alpha 7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFNA7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IFNA7

Target: IFNA7 (IFNa7) (Interferon, alpha 7 (IFNa7))

Andere Bezeichnung: IFN alpha 7

Hintergrund: IFNA7 belongs to the alpha/beta interferon family. IFNA7 is produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Molekulargewicht: 22 kDa (MW of target protein)

Pathways: JAK-STAT Signalweg, Hepatitis C