APOA4 Antikörper (C-Term)

Produktnummer ABIN634002

Der Kaninchen Polyklonal anti-APOA4 Antikörper (ABIN634002) detektiert spezifisch APOA4 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für APOA4 Antikörper (C-Term) (ABIN634002)

Target: APOA4 (Apolipoprotein A-IV (APOA4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APOA4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-APOA4 Antikörper

Bindungsspezifität: C-Term

Spezifität: ApoA-IV antibody was raised against the C terminal of APOA4

Aufreinigung: Affinity purified

Immunogen: ApoA-IV antibody was raised using the C terminal of APOA4 corresponding to a region with amino acids RQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ApoA-IV Blocking Peptide, (ABIN5612111), is also available for use as a blocking control in assays to test for specificity of this ApoA-IV antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu APOA4

Target: APOA4 (Apolipoprotein A-IV (APOA4))

Andere Bezeichnung: ApoA-IV

Hintergrund: The gene encoding APOA4 protein contains 3 exons separated by two introns. A sequence polymorphism has been identified in the 3'UTR of the third exon. The primary translation product is a 396-residue preprotein which after proteolytic processing is secreted its primary site of synthesis, the intestine, in association with chylomicron particles. Although its precise function is not known, apo A-IV is a potent activator of lecithin-cholesterol acyltransferase in vitro.

Molekulargewicht: 43 kDa (MW of target protein)

Pathways: Lipid Metabolism