PAI1 Antikörper (C-Term)

Produktnummer ABIN634000

Produktdetails anti-PAI1 Antikörper

Target: PAI1 (SERPINE1) (Plasminogen Activator Inhibitor 1 (SERPINE1))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PAI1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SERPINE1 antibody was raised against the C terminal of SERPINE1

Aufreinigung: Affinity purified

Immunogen: SERPINE1 antibody was raised using the C terminal of SERPINE1 corresponding to a region with amino acids VNESGTVASSSTAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVM

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SERPINE1 Blocking Peptide, catalog no. 33R-9703, is also available for use as a blocking control in assays to test for specificity of this SERPINE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PAI1

Target: PAI1 (SERPINE1) (Plasminogen Activator Inhibitor 1 (SERPINE1))

Andere Bezeichnung: SERPINE1 (SERPINE1 Produkte)

Synonyme: PAI antikoerper, PAI-1 antikoerper, PAI1 antikoerper, PLANH1 antikoerper, SERPINE1 antikoerper, si:ch211-138a11.1 antikoerper, Planh1 antikoerper, PAI1A antikoerper, Pai1 antikoerper, Pai1aa antikoerper, Planh antikoerper, RATPAI1A antikoerper, serpin family E member 1 antikoerper, serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1 L homeolog antikoerper, serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1 antikoerper, serine (or cysteine) peptidase inhibitor, clade E, member 1 antikoerper, SERPINE1 antikoerper, serpine1.L antikoerper, serpine1 antikoerper, Serpine1 antikoerper

Hintergrund: SERPINE1 acts as 'bait' for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis.

Molekulargewicht: 43 kDa (MW of target protein)

Pathways: p53 Signalweg, Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Autophagie, Smooth Muscle Cell Migration