PAI1 Antikörper (N-Term)
-
- Target Alle PAI1 (SERPINE1) Antikörper anzeigen
- PAI1 (SERPINE1) (Plasminogen Activator Inhibitor 1 (SERPINE1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PAI1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SERPINE1 antibody was raised against the N terminal of SERPINE1
- Aufreinigung
- Affinity purified
- Immunogen
- SERPINE1 antibody was raised using the N terminal of SERPINE1 corresponding to a region with amino acids VAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQ
- Top Product
- Discover our top product SERPINE1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SERPINE1 Blocking Peptide, catalog no. 33R-9417, is also available for use as a blocking control in assays to test for specificity of this SERPINE1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINE1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PAI1 (SERPINE1) (Plasminogen Activator Inhibitor 1 (SERPINE1))
- Andere Bezeichnung
- SERPINE1 (SERPINE1 Produkte)
- Synonyme
- PAI antikoerper, PAI-1 antikoerper, PAI1 antikoerper, PLANH1 antikoerper, SERPINE1 antikoerper, si:ch211-138a11.1 antikoerper, Planh1 antikoerper, PAI1A antikoerper, Pai1 antikoerper, Pai1aa antikoerper, Planh antikoerper, RATPAI1A antikoerper, serpin family E member 1 antikoerper, serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1 L homeolog antikoerper, serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1 antikoerper, serine (or cysteine) peptidase inhibitor, clade E, member 1 antikoerper, SERPINE1 antikoerper, serpine1.L antikoerper, serpine1 antikoerper, Serpine1 antikoerper
- Hintergrund
- SERPINE1 acts as 'bait' for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis.
- Molekulargewicht
- 43 kDa (MW of target protein)
- Pathways
- p53 Signalweg, Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Autophagie, Smooth Muscle Cell Migration
-