LCN6 Antikörper (Middle Region)

Produktnummer ABIN633968

Produktdetails anti-LCN6 Antikörper

Target: LCN6 (Lipocalin 6 (LCN6))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LCN6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Lipocalin 6 antibody was raised against the middle region of LCN6

Aufreinigung: Affinity purified

Immunogen: Lipocalin 6 antibody was raised using the middle region of LCN6 corresponding to a region with amino acids LWVLATNFRDYAIIFTQLEFGDEPFNTVELYSLTETASQEAMGLFTKWSR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Lipocalin 6 Blocking Peptide, catalog no. 33R-5559, is also available for use as a blocking control in assays to test for specificity of this Lipocalin 6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCN6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LCN6

Target: LCN6 (Lipocalin 6 (LCN6))

Andere Bezeichnung: Lipocalin 6 (LCN6 Produkte)

Hintergrund: LCN6 may play a role in male fertility.

Molekulargewicht: 18 kDa (MW of target protein)