Calreticulin 3 Antikörper (N-Term)

Produktnummer ABIN633963

Dieses Anti-Calreticulin 3-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Calreticulin 3 in WB. Geeignet für Human.

Kurzübersicht für Calreticulin 3 Antikörper (N-Term) (ABIN633963)

Target: Calreticulin 3 (CALR3)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Calreticulin 3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Calreticulin 3 Antikörper

Bindungsspezifität: N-Term

Spezifität: Calreticulin 3 antibody was raised against the N terminal of CALR3

Aufreinigung: Affinity purified

Immunogen: Calreticulin 3 antibody was raised using the N terminal of CALR3 corresponding to a region with amino acids MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Calreticulin 3 Blocking Peptide, (ABIN5612590), is also available for use as a blocking control in assays to test for specificity of this Calreticulin 3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CALR3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Calreticulin 3

Target: Calreticulin 3 (CALR3)

Andere Bezeichnung: Calreticulin 3

Hintergrund: Calreticulins, such as CALR3, are Ca(2+)-binding chaperones localized mainly in the endoplasmic/sarcoplasmic reticulum.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: Activation of Innate immune Response