Decorin Antikörper (C-Term)

Produktnummer ABIN633958

Produktdetails anti-Decorin Antikörper

Target: Decorin (DCN)

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Decorin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Decorin antibody was raised against the C terminal of DCN

Aufreinigung: Affinity purified

Immunogen: Decorin antibody was raised using the C terminal of DCN corresponding to a region with amino acids FCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Decorin Blocking Peptide, catalog no. 33R-2856, is also available for use as a blocking control in assays to test for specificity of this Decorin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Decorin

Target: Decorin (DCN)

Andere Bezeichnung: Decorin (DCN Produkte)

Synonyme: CSCD antikoerper, DSPG2 antikoerper, PG40 antikoerper, PGII antikoerper, PGS2 antikoerper, SLRR1B antikoerper, DC antikoerper, mDcn antikoerper, cscd antikoerper, dspg2 antikoerper, pg40 antikoerper, pgii antikoerper, pgs2 antikoerper, slrr1b antikoerper, decorin antikoerper, decorin L homeolog antikoerper, DCN antikoerper, Dcn antikoerper, dcn.L antikoerper, dcn antikoerper

Hintergrund: DCN is a small cellular or pericellular matrix proteoglycan that is closely related in structure to biglycan protein. DCN and biglycan are thought to be the result of a gene duplication. This protein is a component of connective tissue, binds to type I collagen fibrils, and plays a role in matrix assembly. It contains one attached glycosaminoglycan chain. This protein is capable of suppressing the growth of various tumor cell lines. There are multiple alternatively spliced transcript variants known for this gene. This gene is a candidate gene for Marfan syndrome.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process