Decorin Antikörper (C-Term)

Produktnummer ABIN633958

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch Decorin in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Hund.

Kurzübersicht für Decorin Antikörper (C-Term) (ABIN633958)

Target: Decorin (DCN)

Reaktivität: Human, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Decorin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Decorin Antikörper

Bindungsspezifität: C-Term

Spezifität: Decorin antibody was raised against the C terminal of DCN

Aufreinigung: Affinity purified

Immunogen: Decorin antibody was raised using the C terminal of DCN corresponding to a region with amino acids FCPPGHNTKKASYSGVSLFSNPVQYWEIQPSTFRCVYVRSAIQLGNYK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Decorin Blocking Peptide, (ABIN938242), is also available for use as a blocking control in assays to test for specificity of this Decorin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DCN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Decorin

Target: Decorin (DCN)

Andere Bezeichnung: Decorin

Hintergrund: DCN is a small cellular or pericellular matrix proteoglycan that is closely related in structure to biglycan protein. DCN and biglycan are thought to be the result of a gene duplication. This protein is a component of connective tissue, binds to type I collagen fibrils, and plays a role in matrix assembly. It contains one attached glycosaminoglycan chain. This protein is capable of suppressing the growth of various tumor cell lines. There are multiple alternatively spliced transcript variants known for this gene. This gene is a candidate gene for Marfan syndrome.

Molekulargewicht: 36 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process