IFNA5 Antikörper (Middle Region)
-
- Target Alle IFNA5 Antikörper anzeigen
- IFNA5 (Interferon, alpha 5 (IFNA5))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser IFNA5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- IFN Alpha 5 antibody was raised against the middle region of IFNA5
- Aufreinigung
- Affinity purified
- Immunogen
- IFN Alpha 5 antibody was raised using the middle region of IFNA5 corresponding to a region with amino acids TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY
- Top Product
- Discover our top product IFNA5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
IFN Alpha 5 Blocking Peptide, catalog no. 33R-9048, is also available for use as a blocking control in assays to test for specificity of this IFN Alpha 5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFNA5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IFNA5 (Interferon, alpha 5 (IFNA5))
- Andere Bezeichnung
- IFN alpha 5 (IFNA5 Produkte)
- Synonyme
- IFN-alpha-5 antikoerper, IFN-alphaG antikoerper, INA5 antikoerper, INFA5 antikoerper, leIF G antikoerper, Ifa5 antikoerper, IFN-ALPHA-5 antikoerper, interferon alpha 5 antikoerper, interferon, alpha 5 antikoerper, interferon alpha family, gene 5 antikoerper, IFNA5 antikoerper, Ifna5 antikoerper, IFN-ALPHA-5 antikoerper
- Hintergrund
- Alpha interferon suppresses the cyclin D3 and cdc25A genes, leading to a reversible G0-like arrest.
- Molekulargewicht
- 20 kDa (MW of target protein)
- Pathways
- JAK-STAT Signalweg, Hepatitis C
-