IFNA5 Antikörper (Middle Region)

Produktnummer ABIN633933

Dieses Anti-IFNA5-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von IFNA5 in WB. Geeignet für Human.

Kurzübersicht für IFNA5 Antikörper (Middle Region) (ABIN633933)

Target: IFNA5 (Interferon, alpha 5 (IFNA5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IFNA5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-IFNA5 Antikörper

Bindungsspezifität: Middle Region

Spezifität: IFN Alpha 5 antibody was raised against the middle region of IFNA5

Aufreinigung: Affinity purified

Immunogen: IFN Alpha 5 antibody was raised using the middle region of IFNA5 corresponding to a region with amino acids TELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IFN Alpha 5 Blocking Peptide, (ABIN5614145), is also available for use as a blocking control in assays to test for specificity of this IFN Alpha 5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFNA5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IFNA5

Target: IFNA5 (Interferon, alpha 5 (IFNA5))

Andere Bezeichnung: IFN alpha 5

Hintergrund: Alpha interferon suppresses the cyclin D3 and cdc25A genes, leading to a reversible G0-like arrest.

Molekulargewicht: 20 kDa (MW of target protein)

Pathways: JAK-STAT Signalweg, Hepatitis C