GSTM1 Antikörper (N-Term)

Produktnummer ABIN633921

Produktdetails anti-GSTM1 Antikörper

Target: GSTM1 (Glutathione S-Transferase mu 1 (GSTM1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GSTM1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GSTM1 antibody was raised against the N terminal of GSTM1

Aufreinigung: Affinity purified

Immunogen: GSTM1 antibody was raised using the N terminal of GSTM1 corresponding to a region with amino acids KKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GSTM1 Blocking Peptide, catalog no. 33R-4498, is also available for use as a blocking control in assays to test for specificity of this GSTM1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTM1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GSTM1

Target: GSTM1 (Glutathione S-Transferase mu 1 (GSTM1))

Andere Bezeichnung: GSTM1 (GSTM1 Produkte)

Synonyme: GST1 antikoerper, GSTM1-1 antikoerper, GSTM1a-1a antikoerper, GSTM1b-1b antikoerper, GTH4 antikoerper, GTM1 antikoerper, H-B antikoerper, MU antikoerper, MU-1 antikoerper, GSTA3 antikoerper, Gstb-1 antikoerper, Gstb1 antikoerper, gst-mu antikoerper, gst1 antikoerper, gstm1 antikoerper, gstm2 antikoerper, gth4 antikoerper, gtm1 antikoerper, glutathione S-transferase mu 1 antikoerper, glutathione S-transferase M1 antikoerper, glutathione S-transferase, mu 1 antikoerper, glutathione S-transferase Mu 1 antikoerper, glutathione S-transferase mu 2 (muscle) antikoerper, glutathione S-transferase mu 1 L homeolog antikoerper, GSTM1 antikoerper, Gstm1 antikoerper, LOC100356307 antikoerper, GSTM2 antikoerper, LOC100731426 antikoerper, gstm1.L antikoerper

Hintergrund: Cytosolic and membrane-bound forms of glutathione S-transferase are two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. GSTM1 a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione.

Molekulargewicht: 24 kDa (MW of target protein)

Pathways: Negative Regulation of Transporter Activity