CPE Antikörper (N-Term)

Produktnummer ABIN633904

Produktdetails anti-CPE Antikörper

Target: CPE (Carboxypeptidase E (CPE))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Carboxypeptidase E antibody was raised against the N terminal of CPE

Aufreinigung: Affinity purified

Immunogen: Carboxypeptidase E antibody was raised using the N terminal of CPE corresponding to a region with amino acids GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Carboxypeptidase E Blocking Peptide, catalog no. 33R-3440, is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase E antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CPE

Target: CPE (Carboxypeptidase E (CPE))

Andere Bezeichnung: Carboxypeptidase E (CPE Produkte)

Synonyme: CPE antikoerper, CPH antikoerper, Cph-1 antikoerper, Cph1 antikoerper, R74677 antikoerper, fat antikoerper, CARBE antikoerper, Cph antikoerper, si:ch211-198g9.2 antikoerper, zgc:85981 antikoerper, carboxypeptidase E antikoerper, carboxypeptidase E L homeolog antikoerper, CPE antikoerper, cpe antikoerper, Cpe antikoerper, cpe.L antikoerper

Hintergrund: CPE is a carboxypeptidase that cleaves C-terminal amino acid residues and is involved in the biosynthesis of peptide hormones and neurotransmitters, including insulin. It is a peripheral membrane protein. The protein specifically binds regulated secretory pathway proteins, including prohormones, but not constitutively secreted proteins.

Molekulargewicht: 52 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Synaptic Membrane