PYCR1 Antikörper (Middle Region)

Produktnummer ABIN633902

Der Kaninchen Polyklonal anti-PYCR1 Antikörper wird verwendet zum Nachweis von PYCR1 in Proben von Human und Ratte. Er wurde validiert für WB.

Kurzübersicht für PYCR1 Antikörper (Middle Region) (ABIN633902)

Target: PYCR1 (Pyrroline-5-Carboxylate Reductase 1 (PYCR1))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PYCR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PYCR1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PYCR1 antibody was raised against the middle region of PYCR1

Aufreinigung: Affinity purified

Immunogen: PYCR1 antibody was raised using the middle region of PYCR1 corresponding to a region with amino acids KMLLHSEQHPGQLKDNVSSPGGATIHALHVLESGGFRSLLINAVEASCIR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PYCR1 Blocking Peptide, (ABIN939945), is also available for use as a blocking control in assays to test for specificity of this PYCR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PYCR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PYCR1

Target: PYCR1 (Pyrroline-5-Carboxylate Reductase 1 (PYCR1))

Andere Bezeichnung: PYCR1

Hintergrund: This gene encodes an enzyme that catalyzes the NAD(P)H-dependent conversion of pyrroline-5-carboxylate to proline. This enzyme may also play a physiologic role in the generation of NADP(+) in some cell types.

Molekulargewicht: 33 kDa (MW of target protein)