Endonuclease G Antikörper (Middle Region)

Produktnummer ABIN633888

Dieses Anti-Endonuclease G-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Endonuclease G in WB. Geeignet für Human, Ratte und Maus.

Kurzübersicht für Endonuclease G Antikörper (Middle Region) (ABIN633888)

Target: Endonuclease G (ENDOG)

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Endonuclease G Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Endonuclease G Antikörper

Bindungsspezifität: Middle Region

Spezifität: ENDOG antibody was raised against the middle region of ENDOG

Aufreinigung: Affinity purified

Immunogen: ENDOG antibody was raised using the middle region of ENDOG corresponding to a region with amino acids YVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ENDOG Blocking Peptide, (ABIN936261), is also available for use as a blocking control in assays to test for specificity of this ENDOG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENDOG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Endonuclease G

Target: Endonuclease G (ENDOG)

Andere Bezeichnung: ENDOG

Hintergrund: ENDOG cleaves DNA at double-stranded (DG)n.(DC)n and at single-stranded (DC)n tracts. In addition to deoxyribonuclease activities, ENDOG also has ribonuclease (RNase) and RNase H activities. ENDOG is capable of generating the RNA primers required by DNA polymerase gamma to initiate replication of mitochondrial DNA.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Apoptose