IGFBP7 Antikörper (C-Term)

Produktnummer ABIN633886

Produktdetails anti-IGFBP7 Antikörper

Target: IGFBP7 (Insulin-Like Growth Factor Binding Protein 7 (IGFBP7))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IGFBP7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IGFBP7 antibody was raised against the C terminal of IGFBP7

Aufreinigung: Affinity purified

Immunogen: IGFBP7 antibody was raised using the C terminal of IGFBP7 corresponding to a region with amino acids RGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IGFBP7 Blocking Peptide, catalog no. 33R-7926, is also available for use as a blocking control in assays to test for specificity of this IGFBP7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IGFBP7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IGFBP7

Target: IGFBP7 (Insulin-Like Growth Factor Binding Protein 7 (IGFBP7))

Andere Bezeichnung: IGFBP7 (IGFBP7 Produkte)

Synonyme: zgc:85888 antikoerper, AGM antikoerper, FSTL2 antikoerper, IBP-7 antikoerper, IGFBP-7 antikoerper, IGFBP-7v antikoerper, IGFBPRP1 antikoerper, MAC25 antikoerper, PSF antikoerper, RAMSVPS antikoerper, TAF antikoerper, Fstl2 antikoerper, Mac25 antikoerper, insulin like growth factor binding protein 7 antikoerper, insulin-like growth factor binding protein 7 antikoerper, IGFBP7 antikoerper, igfbp7 antikoerper, Igfbp7 antikoerper

Hintergrund: IGFBP7 contains 1 Ig-like C2-type (immunoglobulin-like) domain, 1 IGFBP N-terminal domain and 1 Kazal-like domain. It binds IGF-I and IGF-II with a relatively low affinity. IGFBP7 stimulates prostacyclin (PGI2) production.

Molekulargewicht: 29 kDa (MW of target protein)

Pathways: Growth Factor Binding