CBLN4 Antikörper (C-Term)

Produktnummer ABIN633873

Produktdetails anti-CBLN4 Antikörper

Target: CBLN4 (Cerebellin 4 Precursor (CBLN4))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CBLN4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CBLN4 antibody was raised against the C terminal of CBLN4

Aufreinigung: Affinity purified

Immunogen: CBLN4 antibody was raised using the C terminal of CBLN4 corresponding to a region with amino acids HVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CBLN4 Blocking Peptide, catalog no. 33R-3868, is also available for use as a blocking control in assays to test for specificity of this CBLN4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CBLN4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CBLN4

Target: CBLN4 (Cerebellin 4 Precursor (CBLN4))

Andere Bezeichnung: CBLN4 (CBLN4 Produkte)

Synonyme: zgc:172190 antikoerper, cerebellin-4 antikoerper, CBLNL1 antikoerper, AI848962 antikoerper, cerebellin 4 precursor antikoerper, cerebellin 4 precursor L homeolog antikoerper, cerebellin 4 precursor protein antikoerper, CBLN4 antikoerper, cbln4 antikoerper, cbln4.L antikoerper, Cbln4 antikoerper

Hintergrund: Cerebellin is a sixteen aa peptide found mainly in the adrenal medulla, where it has been shown to have a neuromodulatory function. Cerebellin is derived from precerebellin, a protein with sequence similarity to the noncollagen domain of complement component C1qB. CBLN4 is a glycoprotein which shares sequence similarity with precerebellin.

Molekulargewicht: 22 kDa (MW of target protein)