NOMO1 Antikörper (C-Term)

Produktnummer ABIN633864

Dieses Anti-NOMO1-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von NOMO1 in WB. Geeignet für Human, Ratte und Maus.

Kurzübersicht für NOMO1 Antikörper (C-Term) (ABIN633864)

Target: NOMO1 (NODAL Modulator 1 (NOMO1))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NOMO1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-NOMO1 Antikörper

Bindungsspezifität: C-Term

Spezifität: NOMO1 antibody was raised against the C terminal of NOMO1

Aufreinigung: Affinity purified

Immunogen: NOMO1 antibody was raised using the C terminal of NOMO1 corresponding to a region with amino acids QDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQAASD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NOMO1 Blocking Peptide, (ABIN5615024), is also available for use as a blocking control in assays to test for specificity of this NOMO1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOMO1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NOMO1

Target: NOMO1 (NODAL Modulator 1 (NOMO1))

Andere Bezeichnung: NOMO1

Hintergrund: NOMO1 was originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE).

Molekulargewicht: 134 kDa (MW of target protein)