PLA2G5 Antikörper (N-Term)
-
- Target Alle PLA2G5 Antikörper anzeigen
- PLA2G5 (phospholipase A2, Group V (PLA2G5))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PLA2G5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PLA2 G5 antibody was raised against the N terminal of PLA2 5
- Aufreinigung
- Affinity purified
- Immunogen
- PLA2 G5 antibody was raised using the N terminal of PLA2 5 corresponding to a region with amino acids MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW
- Top Product
- Discover our top product PLA2G5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PLA2G5 Blocking Peptide, catalog no. 33R-6140, is also available for use as a blocking control in assays to test for specificity of this PLA2G5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLA0 5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PLA2G5 (phospholipase A2, Group V (PLA2G5))
- Andere Bezeichnung
- PLA2G5 (PLA2G5 Produkte)
- Synonyme
- PLA2 antikoerper, sPLA2 antikoerper, FRFB antikoerper, GV-PLA2 antikoerper, PLA2-10 antikoerper, hVPLA(2) antikoerper, phospholipase A2 group V antikoerper, phospholipase A2, group V antikoerper, PLA2G5 antikoerper, Pla2g5 antikoerper
- Hintergrund
- This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1.
- Molekulargewicht
- 14 kDa (MW of target protein)
- Pathways
- Inositol Metabolic Process
-