PLA2G5 Antikörper (N-Term)

Produktnummer ABIN633845

Der Kaninchen Polyklonal Anti-PLA2G5-Antikörper wurde für WB validiert. Er ist geeignet, PLA2G5 in Proben von Human zu detektieren.

Kurzübersicht für PLA2G5 Antikörper (N-Term) (ABIN633845)

Target: PLA2G5 (phospholipase A2, Group V (PLA2G5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PLA2G5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PLA2G5 Antikörper

Bindungsspezifität: N-Term

Spezifität: PLA2 G5 antibody was raised against the N terminal of PLA2 5

Aufreinigung: Affinity purified

Immunogen: PLA2 G5 antibody was raised using the N terminal of PLA2 5 corresponding to a region with amino acids MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PLA2G5 Blocking Peptide, (ABIN5615403), is also available for use as a blocking control in assays to test for specificity of this PLA2G5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLA0 5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PLA2G5

Target: PLA2G5 (phospholipase A2, Group V (PLA2G5))

Andere Bezeichnung: PLA2G5

Hintergrund: This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1.

Molekulargewicht: 14 kDa (MW of target protein)

Pathways: Inositol Metabolic Process