APOE Antikörper (N-Term)

Produktnummer ABIN633837

Produktdetails anti-APOE Antikörper

Target: APOE (Apolipoprotein E (APOE))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser APOE Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ApoE antibody was raised against the N terminal of APOE

Aufreinigung: Affinity purified

Immunogen: ApoE antibody was raised using the N terminal of APOE corresponding to a region with amino acids KVLWAALLVTFLAGCQAKVEQAVETEPEPELRQQTEWQSGQRWELALGRF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ApoE Blocking Peptide, catalog no. 33R-4716, is also available for use as a blocking control in assays to test for specificity of this ApoE antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOE antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu APOE

Target: APOE (Apolipoprotein E (APOE))

Andere Bezeichnung: ApoE (APOE Produkte)

Synonyme: ad2 antikoerper, apoprotein antikoerper, im:7036787 antikoerper, wu:fb69a05 antikoerper, zgc:110064 antikoerper, apoe antikoerper, AI255918 antikoerper, AD2 antikoerper, LDLCQ5 antikoerper, LPG antikoerper, APOEA antikoerper, Apo-E antikoerper, apolipoprotein E antikoerper, apolipoprotein Ea antikoerper, apoe antikoerper, apoea antikoerper, Apoe antikoerper, APOE antikoerper

Hintergrund: Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.

Molekulargewicht: 34 kDa (MW of target protein)

Pathways: Regulation of Cell Size, Lipid Metabolism