PHGDH Antikörper (Middle Region)

Produktnummer ABIN633828

Der Kaninchen Polyklonal anti-PHGDH Antikörper (ABIN633828) detektiert spezifisch PHGDH in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für PHGDH Antikörper (Middle Region) (ABIN633828)

Target: PHGDH (phosphoglycerate Dehydrogenase (PHGDH))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PHGDH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PHGDH Antikörper

Bindungsspezifität: Middle Region

Spezifität: PHGDH antibody was raised against the middle region of PHGDH

Aufreinigung: Affinity purified

Immunogen: PHGDH antibody was raised using the middle region of PHGDH corresponding to a region with amino acids CAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PHGDH Blocking Peptide, (ABIN937027), is also available for use as a blocking control in assays to test for specificity of this PHGDH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHGDH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PHGDH

Target: PHGDH (phosphoglycerate Dehydrogenase (PHGDH))

Andere Bezeichnung: PHGDH

Hintergrund: 3-Phosphoglycerate dehydrogenase (PHGDH) catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor.3-Phosphoglycerate dehydrogenase (PHGDH, EC 1.1.1.95) catalyzes the transition of 3-phosphoglycerate into 3-phosphohydroxypyruvate, which is the first and rate-limiting step in the phosphorylated pathway of serine biosynthesis, using NAD+/NADH as a cofactor.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, Warburg Effekt