Cardiotrophin 1 Antikörper (N-Term)

Produktnummer ABIN633827

Der Kaninchen Polyklonal anti-Cardiotrophin 1 Antikörper wird verwendet zum Nachweis von Cardiotrophin 1 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für Cardiotrophin 1 Antikörper (N-Term) (ABIN633827)

Target: Cardiotrophin 1 (CTF1)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Cardiotrophin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Cardiotrophin 1 Antikörper

Bindungsspezifität: N-Term

Spezifität: Cardiotrophin 1 antibody was raised against the N terminal of CTF1

Aufreinigung: Affinity purified

Immunogen: Cardiotrophin 1 antibody was raised using the N terminal of CTF1 corresponding to a region with amino acids MSRREGSLEDPQTDSSVSLLPHLEAKIRQTHSLAHLLTKYAEQLLQEYVQ

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cardiotrophin 1 Blocking Peptide, (ABIN5612622), is also available for use as a blocking control in assays to test for specificity of this Cardiotrophin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Cardiotrophin 1

Target: Cardiotrophin 1 (CTF1)

Andere Bezeichnung: Cardiotrophin 1

Hintergrund: CTF1 induces cardiac myocyte hypertrophy in vitro. It binds to and activates the ILST/gp130 receptor. It belongs to the IL-6 superfamily.

Molekulargewicht: 21 kDa (MW of target protein)

Pathways: JAK-STAT Signalweg