KCNK5 Antikörper (C-Term)

Produktnummer ABIN633797

Der Kaninchen Polyklonal Anti-KCNK5-Antikörper wurde für WB validiert. Er ist geeignet, KCNK5 in Proben von Human zu detektieren.

Kurzübersicht für KCNK5 Antikörper (C-Term) (ABIN633797)

Target: KCNK5 (Potassium Channel, Subfamily K, Member 5 (KCNK5))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KCNK5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-KCNK5 Antikörper

Bindungsspezifität: C-Term

Spezifität: KCNK5 antibody was raised against the C terminal of KCNK5

Aufreinigung: Affinity purified

Immunogen: KCNK5 antibody was raised using the C terminal of KCNK5 corresponding to a region with amino acids TFVNTEAGLSDEETSKSSLEDNLAGEESPQQGAEAKAPLNMGEFPSSSES

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KCNK5 Blocking Peptide, (ABIN5614288), is also available for use as a blocking control in assays to test for specificity of this KCNK5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KCNK5

Target: KCNK5 (Potassium Channel, Subfamily K, Member 5 (KCNK5))

Andere Bezeichnung: KCNK5

Hintergrund: KCNK5 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. KCNK5 is mainly expressed in the cortical distal tubules and collecting ducts of the kidney. The protein is highly sensitive to external pH and this, in combination with its expression pattern, suggests it may play an important role in renal potassium transport.

Molekulargewicht: 55 kDa (MW of target protein)