CHRNA3 Antikörper (N-Term)
-
- Target Alle CHRNA3 Antikörper anzeigen
- CHRNA3 (Cholinergic Receptor, Nicotinic, alpha 3 (Neuronal) (CHRNA3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CHRNA3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CHRNA3 antibody was raised against the N terminal of CHRNA3
- Aufreinigung
- Affinity purified
- Immunogen
- CHRNA3 antibody was raised using the N terminal of CHRNA3 corresponding to a region with amino acids EHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETN
- Top Product
- Discover our top product CHRNA3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CHRNA3 Blocking Peptide, catalog no. 33R-2458, is also available for use as a blocking control in assays to test for specificity of this CHRNA3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHRNA3 (Cholinergic Receptor, Nicotinic, alpha 3 (Neuronal) (CHRNA3))
- Andere Bezeichnung
- CHRNA3 (CHRNA3 Produkte)
- Synonyme
- LNCR2 antikoerper, NACHRA3 antikoerper, PAOD2 antikoerper, (a)3 antikoerper, A730007P14Rik antikoerper, Acra-3 antikoerper, Acra3 antikoerper, cholinergic receptor nicotinic alpha 3 subunit antikoerper, cholinergic receptor, nicotinic, alpha polypeptide 3 antikoerper, CHRNA3 antikoerper, Chrna3 antikoerper
- Hintergrund
- The CHRNA3 subunit is expressed in the soma of the majority of pyramidal cells, with the most alpha 3 immunoreactivity observed in CA2-4 and entorhinal cortex and relatively less in CA1 and subicular pyramidal cell soma.
- Molekulargewicht
- 57 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-