CHRNA3 Antikörper (N-Term)

Produktnummer ABIN633761

Produktdetails anti-CHRNA3 Antikörper

Target: CHRNA3 (Cholinergic Receptor, Nicotinic, alpha 3 (Neuronal) (CHRNA3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHRNA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CHRNA3 antibody was raised against the N terminal of CHRNA3

Aufreinigung: Affinity purified

Immunogen: CHRNA3 antibody was raised using the N terminal of CHRNA3 corresponding to a region with amino acids EHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHRNA3 Blocking Peptide, catalog no. 33R-2458, is also available for use as a blocking control in assays to test for specificity of this CHRNA3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHRNA3

Target: CHRNA3 (Cholinergic Receptor, Nicotinic, alpha 3 (Neuronal) (CHRNA3))

Andere Bezeichnung: CHRNA3 (CHRNA3 Produkte)

Synonyme: LNCR2 antikoerper, NACHRA3 antikoerper, PAOD2 antikoerper, (a)3 antikoerper, A730007P14Rik antikoerper, Acra-3 antikoerper, Acra3 antikoerper, cholinergic receptor nicotinic alpha 3 subunit antikoerper, cholinergic receptor, nicotinic, alpha polypeptide 3 antikoerper, CHRNA3 antikoerper, Chrna3 antikoerper

Hintergrund: The CHRNA3 subunit is expressed in the soma of the majority of pyramidal cells, with the most alpha 3 immunoreactivity observed in CA2-4 and entorhinal cortex and relatively less in CA1 and subicular pyramidal cell soma.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Synaptic Membrane