CHRNA3 Antikörper (N-Term)

Produktnummer ABIN633761

Der Kaninchen-Polyklonal Anti-CHRNA3-Antikörper wurde für WB validiert. Er ist geeignet zum Nachweis von CHRNA3 in Proben aus Human, Maus und Ratte. }

Kurzübersicht für CHRNA3 Antikörper (N-Term) (ABIN633761)

Target: CHRNA3 (Cholinergic Receptor, Nicotinic, alpha 3 (Neuronal) (CHRNA3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHRNA3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CHRNA3 Antikörper

Bindungsspezifität: N-Term

Spezifität: CHRNA3 antibody was raised against the N terminal of CHRNA3

Aufreinigung: Affinity purified

Immunogen: CHRNA3 antibody was raised using the N terminal of CHRNA3 corresponding to a region with amino acids EHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHRNA3 Blocking Peptide, (ABIN937844), is also available for use as a blocking control in assays to test for specificity of this CHRNA3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHRNA3

Target: CHRNA3 (Cholinergic Receptor, Nicotinic, alpha 3 (Neuronal) (CHRNA3))

Andere Bezeichnung: CHRNA3

Hintergrund: The CHRNA3 subunit is expressed in the soma of the majority of pyramidal cells, with the most alpha 3 immunoreactivity observed in CA2-4 and entorhinal cortex and relatively less in CA1 and subicular pyramidal cell soma.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Synaptic Membrane