CHRNA4 Antikörper (N-Term)

Produktnummer ABIN633758

Produktdetails anti-CHRNA4 Antikörper

Target: CHRNA4 (Cholinergic Receptor, Nicotinic, alpha 4 (CHRNA4))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CHRNA4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CHRNA4 antibody was raised against the N terminal of CHRNA4

Aufreinigung: Affinity purified

Immunogen: CHRNA4 antibody was raised using the N terminal of CHRNA4 corresponding to a region with amino acids AEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CHRNA4 Blocking Peptide, catalog no. 33R-1126, is also available for use as a blocking control in assays to test for specificity of this CHRNA4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CHRNA4

Target: CHRNA4 (Cholinergic Receptor, Nicotinic, alpha 4 (CHRNA4))

Andere Bezeichnung: CHRNA4 (CHRNA4 Produkte)

Synonyme: NACHRA4 antikoerper, BFNC antikoerper, EBN antikoerper, EBN1 antikoerper, NACHR antikoerper, NACRA4 antikoerper, NARAC antikoerper, Acra-4 antikoerper, Acra4 antikoerper, ENFL1 antikoerper, neuronal acetylcholine receptor subunit alpha-4 antikoerper, neuronal acetylcholine receptor subunit alpha-4-like antikoerper, cholinergic receptor nicotinic alpha 4 subunit antikoerper, cholinergic receptor, nicotinic, alpha 4b antikoerper, cholinergic receptor, nicotinic, alpha polypeptide 4 antikoerper, CpipJ_CPIJ002434 antikoerper, LOC100368057 antikoerper, CHRNA4 antikoerper, chrna4b antikoerper, Chrna4 antikoerper

Hintergrund: CHRNA4 is a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described.

Molekulargewicht: 67 kDa (MW of target protein)

Pathways: Synaptic Membrane