MCOLN1 Antikörper (N-Term)

Produktnummer ABIN633712

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MCOLN1 in WB. Er zeigt eine Reaktivität gegenüber Human und Hund.

Kurzübersicht für MCOLN1 Antikörper (N-Term) (ABIN633712)

Target: MCOLN1 (Mucolipin 1 (MCOLN1))

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MCOLN1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MCOLN1 Antikörper

Bindungsspezifität: N-Term

Spezifität: Mucolipin 1 antibody was raised against the N terminal of MCOLN1

Aufreinigung: Affinity purified

Immunogen: Mucolipin 1 antibody was raised using the N terminal of MCOLN1 corresponding to a region with amino acids FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Mucolipin 1 Blocking Peptide, (ABIN938435), is also available for use as a blocking control in assays to test for specificity of this Mucolipin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCOLN1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MCOLN1

Target: MCOLN1 (Mucolipin 1 (MCOLN1))

Andere Bezeichnung: Mucolipin 1

Hintergrund: MCOLN1 encodes a protein that may be involved in calcium signaling and membrane trafficking in mucolipidosis IV.

Molekulargewicht: 64 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis