FXR1 Antikörper (C-Term)

Produktnummer ABIN633611

Produktdetails anti-FXR1 Antikörper

Target: FXR1 (Fragile X Mental Retardation, Autosomal Homolog 1 (FXR1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FXR1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FXR1 antibody was raised against the C terminal of FXR1

Aufreinigung: Affinity purified

Immunogen: FXR1 antibody was raised using the C terminal of FXR1 corresponding to a region with amino acids EQLRQIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELSDW

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FXR1 Blocking Peptide, catalog no. 33R-2671, is also available for use as a blocking control in assays to test for specificity of this FXR1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FXR1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FXR1

Target: FXR1 (Fragile X Mental Retardation, Autosomal Homolog 1 (FXR1))

Andere Bezeichnung: FXR1 (FXR1 Produkte)

Synonyme: FXR1P antikoerper, wu:fb16f11 antikoerper, wu:fd18c10 antikoerper, zgc:66226 antikoerper, Fxr1h antikoerper, Fxr1p antikoerper, XtFxr1p antikoerper, fxr1h antikoerper, xFxr1p antikoerper, FXR1 antikoerper, 1110050J02Rik antikoerper, 9530073J07Rik antikoerper, AI851072 antikoerper, xfxr1 antikoerper, fxr1 antikoerper, FMR1 autosomal homolog 1 antikoerper, fragile X mental retardation, autosomal homolog 1 antikoerper, fragile X mental retardation gene 1, autosomal homolog antikoerper, FMR1 autosomal homolog 1 L homeolog antikoerper, FMR1 autosomal homolog 1 S homeolog antikoerper, FXR1 antikoerper, fxr1 antikoerper, Fxr1 antikoerper, fxr1.L antikoerper, fxr1.S antikoerper

Hintergrund: FXR1 is an RNA binding protein that interacts with the functionally-similar proteins FMR1 and FXR2. These proteins shuttle between the nucleus and cytoplasm and associate with polyribosomes, predominantly with the 60S ribosomal subunit.

Molekulargewicht: 68 kDa (MW of target protein)