FXR1 Antikörper (C-Term)
Kurzübersicht für FXR1 Antikörper (C-Term) (ABIN633611)
Target
Alle FXR1 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- C-Term
-
Spezifität
- FXR1 antibody was raised against the C terminal of FXR1
-
Aufreinigung
- Affinity purified
-
Immunogen
- FXR1 antibody was raised using the C terminal of FXR1 corresponding to a region with amino acids EQLRQIGSRSYSGRGRGRRGPNYTSGYGTNSELSNPSETESERKDELSDW
-
-
-
-
Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
FXR1 Blocking Peptide, (ABIN938057), is also available for use as a blocking control in assays to test for specificity of this FXR1 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FXR1 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- FXR1 (Fragile X Mental Retardation, Autosomal Homolog 1 (FXR1))
-
Andere Bezeichnung
- FXR1
-
Hintergrund
- FXR1 is an RNA binding protein that interacts with the functionally-similar proteins FMR1 and FXR2. These proteins shuttle between the nucleus and cytoplasm and associate with polyribosomes, predominantly with the 60S ribosomal subunit.
-
Molekulargewicht
- 68 kDa (MW of target protein)
Target
-