SRGN Antikörper (Middle Region)
-
- Target Alle SRGN Antikörper anzeigen
- SRGN (serglycin (SRGN))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SRGN Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Serglycin antibody was raised against the middle region of SRGN
- Aufreinigung
- Affinity purified
- Immunogen
- Serglycin antibody was raised using the middle region of SRGN corresponding to a region with amino acids RTDLFPKTRIQDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDY
- Top Product
- Discover our top product SRGN Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Serglycin Blocking Peptide, catalog no. ABIN5616055, is also available for use as a blocking control in assays to test for specificity of this Serglycin antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SRGN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SRGN (serglycin (SRGN))
- Andere Bezeichnung
- Serglycin (SRGN Produkte)
- Hintergrund
- SRGN is a protein best known as a hematopoietic cell granule proteoglycan. Proteoglycans stored in the secretory granules of many hematopoietic cells also contain a protease-resistant peptide core, which may be important for neutralizing hydrolytic enzymes. SRGN was found to be associated with the macromolecular complex of granzymes and perforin, which may serve as a mediator of granule-mediated apoptosis.
- Molekulargewicht
- 15 kDa (MW of target protein)
- Pathways
- Maintenance of Protein Location
-