CIRBP Antikörper (N-Term)

Produktnummer ABIN633585

Dieses Anti-CIRBP-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von CIRBP in WB. Geeignet für Human.

Kurzübersicht für CIRBP Antikörper (N-Term) (ABIN633585)

Target: CIRBP (Cold Inducible RNA Binding Protein (CIRBP))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CIRBP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CIRBP Antikörper

Bindungsspezifität: N-Term

Spezifität: CIRBP antibody was raised against the N terminal of CIRBP

Aufreinigung: Affinity purified

Immunogen: CIRBP antibody was raised using the N terminal of CIRBP corresponding to a region with amino acids MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFG

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CIRBP Blocking Peptide, (ABIN5612892), is also available for use as a blocking control in assays to test for specificity of this CIRBP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CIRBP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CIRBP

Target: CIRBP (Cold Inducible RNA Binding Protein (CIRBP))

Andere Bezeichnung: CIRBP

Hintergrund: CIRBP contains 1 RRM (RNA recognition motif) domain. It seems to play an essential role in cold-induced suppression of cell proliferation.

Molekulargewicht: 31 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization