DHX34 Antikörper

Produktnummer ABIN633572

Produktdetails anti-DHX34 Antikörper

Target: DHX34 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 34 (DHX34))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DHX34 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DHX34 antibody was raised using a synthetic peptide corresponding to a region with amino acids APQDGPPGAEEAALETLQKTSVLQRPYHCEACGKDFLFTPTEVLRHRKQH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DHX34 Blocking Peptide, catalog no. 33R-1434, is also available for use as a blocking control in assays to test for specificity of this DHX34 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX34 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DHX34

Target: DHX34 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 34 (DHX34))

Andere Bezeichnung: DHX34 (DHX34 Produkte)

Synonyme: DDX34 antikoerper, HRH1 antikoerper, 1200013B07Rik antikoerper, 1810012L18Rik antikoerper, Ddx34 antikoerper, mKIAA0134 antikoerper, DExH-box helicase 34 antikoerper, DEAH (Asp-Glu-Ala-His) box polypeptide 34 antikoerper, DEAH-box helicase 34 antikoerper, DHX34 antikoerper, dhx34 antikoerper, Dhx34 antikoerper

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation.

Molekulargewicht: 128 kDa (MW of target protein)