DHX34 Antikörper

Produktnummer ABIN633327

Produktdetails anti-DHX34 Antikörper

Target: DHX34 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 34 (DHX34))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DHX34 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DHX34 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPGRLFPITVVYQPQEAEPTTSKSEKLDPRPFLRVLESIDHKYPPEERGD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DHX34 Blocking Peptide, catalog no. 33R-9728, is also available for use as a blocking control in assays to test for specificity of this DHX34 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX34 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DHX34

Target: DHX34 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 34 (DHX34))

Andere Bezeichnung: DHX34 (DHX34 Produkte)

Synonyme: DDX34 antikoerper, HRH1 antikoerper, 1200013B07Rik antikoerper, 1810012L18Rik antikoerper, Ddx34 antikoerper, mKIAA0134 antikoerper, DExH-box helicase 34 antikoerper, DEAH (Asp-Glu-Ala-His) box polypeptide 34 antikoerper, DEAH-box helicase 34 antikoerper, DHX34 antikoerper, dhx34 antikoerper, Dhx34 antikoerper

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. It is mapped to the glioma 19q tumor suppressor region and is a tumor suppressor candidate gene.

Molekulargewicht: 97 kDa (MW of target protein)