RG9MTD3 Antikörper
-
- Target Alle RG9MTD3 Antikörper anzeigen
- RG9MTD3 (RNA (Guanine-9-) Methyltransferase Domain Containing 3 (RG9MTD3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RG9MTD3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RG9 MTD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids GEILATGSTAWCSKNVQRKQRHWEKIVAAKKSKRKQEKERRKANRAENPG
- Top Product
- Discover our top product RG9MTD3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RG9MTD3 Blocking Peptide, catalog no. 33R-3230, is also available for use as a blocking control in assays to test for specificity of this RG9MTD3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RG0 TD3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RG9MTD3 (RNA (Guanine-9-) Methyltransferase Domain Containing 3 (RG9MTD3))
- Andere Bezeichnung
- RG9MTD3 (RG9MTD3 Produkte)
- Synonyme
- RG9MTD3 antikoerper, RP11-3J10.9 antikoerper, bA3J10.9 antikoerper, Rg9mtd3 antikoerper, 2610042J10Rik antikoerper, Rnmtd3 antikoerper, tRNA methyltransferase 10B antikoerper, TRMT10B antikoerper, Trmt10b antikoerper
- Hintergrund
- RG9MTD3 belongs to the RNA methyltransferase trmD family, TRM10 subfamily. It is a probable RNA methyltransferase.
- Molekulargewicht
- 36 kDa (MW of target protein)
-