CDKN2AIP Antikörper (N-Term)

Produktnummer ABIN633527

Der Kaninchen Polyklonal Anti-CDKN2AIP-Antikörper wurde für WB validiert. Er ist geeignet, CDKN2AIP in Proben von Human zu detektieren.

Kurzübersicht für CDKN2AIP Antikörper (N-Term) (ABIN633527)

Target: CDKN2AIP (CDKN2A Interacting Protein (CDKN2AIP))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDKN2AIP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CDKN2AIP Antikörper

Bindungsspezifität: N-Term

Spezifität: CDKN2 AIP antibody was raised against the N terminal of CDKN2 IP

Aufreinigung: Affinity purified

Immunogen: CDKN2 AIP antibody was raised using the N terminal of CDKN2 IP corresponding to a region with amino acids RRDFLLRNAGDLAPAGGAASASTDEAADAESGTRNRQLQQLISFSMAWAN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDKN2AIP Blocking Peptide, (ABIN5612800), is also available for use as a blocking control in assays to test for specificity of this CDKN2AIP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDKN0 IP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDKN2AIP

Target: CDKN2AIP (CDKN2A Interacting Protein (CDKN2AIP))

Andere Bezeichnung: CDKN2AIP

Hintergrund: The CDKN2AIP protein activates TP53/p53 by CDKN2A-dependent and CDKN2A-independent pathways.

Molekulargewicht: 61 kDa (MW of target protein)