CDKN2AIP Antikörper (C-Term)
-
- Target Alle CDKN2AIP Antikörper anzeigen
- CDKN2AIP (CDKN2A Interacting Protein (CDKN2AIP))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CDKN2AIP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- CARF antibody was raised against the C terminal Of Carf
- Aufreinigung
- Purified
- Immunogen
- CARF antibody was raised using the C terminal Of Carf corresponding to a region with amino acids AIEALKATLDVFFVPLKELADLPQNKSSQESIVCELRCKSVYLGTGCGKS
-
-
- Applikationshinweise
-
WB: 0.3125 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CARF Blocking Peptide, catalog no. 33R-1263, is also available for use as a blocking control in assays to test for specificity of this CARF antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CARF antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDKN2AIP (CDKN2A Interacting Protein (CDKN2AIP))
- Andere Bezeichnung
- CARF (CDKN2AIP Produkte)
- Synonyme
- CARF antikoerper, 4921511I16Rik antikoerper, AW208986 antikoerper, CDKN2AIP antikoerper, RGD1305302 antikoerper, CDKN2A interacting protein antikoerper, CDKN2A interacting protein L homeolog antikoerper, CDKN2AIP antikoerper, Cdkn2aip antikoerper, cdkn2aip antikoerper, cdkn2aip.L antikoerper
- Hintergrund
- CARF was first cloned as a novel binding partner of ARF from a yeast-interactive screen. CARF and ARF colocalize in the perinucleolar region and have a collaborative function. In the nucleoplasm, CARF interacts with p53 and enhances its function. The p53 downregulates CARF in a negative feedback regulatory loop and may also involve p53 antagonist HDM2.
- Molekulargewicht
- 64 kDa (MW of target protein)
-