CDC5L Antikörper

Produktnummer ABIN633497

Produktdetails anti-CDC5L Antikörper

Target: CDC5L (CDC5 Cell Division Cycle 5-Like (S. Pombe) (CDC5L))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDC5L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CDC5 L antibody was raised using a synthetic peptide corresponding to a region with amino acids LHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDC5L Blocking Peptide, catalog no. 33R-5034, is also available for use as a blocking control in assays to test for specificity of this CDC5L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDC5L

Target: CDC5L (CDC5 Cell Division Cycle 5-Like (S. Pombe) (CDC5L))

Andere Bezeichnung: CDC5L (CDC5L Produkte)

Synonyme: zgc:55853 antikoerper, CDC5L antikoerper, CDC5 antikoerper, CDC5-LIKE antikoerper, CEF1 antikoerper, PCDC5RP antikoerper, dJ319D22.1 antikoerper, 1200002I02Rik antikoerper, AA408004 antikoerper, ARABIDOPSIS THALIANA CELL DIVISION CYCLE 5 antikoerper, ARABIDOPSIS THALIANA MYB DOMAIN CELL DIVISION CYCLE 5 antikoerper, ATCDC5 antikoerper, ATMYBCDC5 antikoerper, F21M12.15 antikoerper, F21M12_15 antikoerper, cell division cycle 5 antikoerper, CDC5 cell division cycle 5-like (S. pombe) antikoerper, cell division cycle 5 like antikoerper, cell division cycle 5-like antikoerper, cell division cycle 5 like S homeolog antikoerper, cell division cycle 5-like (S. pombe) antikoerper, cell division cycle 5 antikoerper, cdc5l antikoerper, CDC5L antikoerper, Chro.50385 antikoerper, Cdc5l antikoerper, cdc5l.S antikoerper, CDC5 antikoerper

Hintergrund: CDC5L shares a significant similarity with Schizosaccharomyces pombe cdc5 gene product, which is a cell cycle regulator important for G2/M transition. CDC5L has been demonstrated to act as a positive regulator of cell cycle G2/M progression. It was also found to be an essential component of a non-snRNA spliceosome, which contains at least five additional protein factors and is required for the second catalytic step of pre-mRNA splicing.

Molekulargewicht: 92 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Chromatin Binding