CDC5L Antikörper

Produktnummer ABIN633497

Der Kaninchen Polyklonal Anti-CDC5L-Antikörper wurde für WB validiert. Er ist geeignet, CDC5L in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für CDC5L Antikörper (ABIN633497)

Target: CDC5L (CDC5 Cell Division Cycle 5-Like (S. Pombe) (CDC5L))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CDC5L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-CDC5L Antikörper

Aufreinigung: Affinity purified

Immunogen: CDC5 L antibody was raised using a synthetic peptide corresponding to a region with amino acids LHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEQGEFEEEEGEDE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CDC5L Blocking Peptide, (ABIN940420), is also available for use as a blocking control in assays to test for specificity of this CDC5L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CDC0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CDC5L

Target: CDC5L (CDC5 Cell Division Cycle 5-Like (S. Pombe) (CDC5L))

Andere Bezeichnung: CDC5L

Hintergrund: CDC5L shares a significant similarity with Schizosaccharomyces pombe cdc5 gene product, which is a cell cycle regulator important for G2/M transition. CDC5L has been demonstrated to act as a positive regulator of cell cycle G2/M progression. It was also found to be an essential component of a non-snRNA spliceosome, which contains at least five additional protein factors and is required for the second catalytic step of pre-mRNA splicing.

Molekulargewicht: 92 kDa (MW of target protein)

Pathways: Activation of Innate immune Response, Chromatin Binding